Structure of PDB 6osa Chain R

Receptor sequence
>6osaR (length=321) Species: 9606 (Homo sapiens) [Search protein sequence]
PSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTLFTLARKKSLQSLQS
TVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRD
ACTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALL
AVPMLFTMGEQNRSADGQHAGGLVCTPTIHTATVKVVIQVNTFMSFIFPM
VVISVLNTIIANKLTVMVRQAAEQCTVGGPGRVQALRHGVRVLRAVVIAF
VVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPI
LYNLVSANFRHIFLATLACLC
3D structure
PDB6osa Conformational transitions of a neurotensin receptor 1-Gi1complex.
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R E53 L54 F127 H131 Y145 M207 V223 T225 R323 F326 D331 W334 Y339 Y342 Y346 E4 L5 F78 H82 Y96 M158 V174 T176 R261 F264 D269 W272 Y277 Y280 Y284
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0016492 G protein-coupled neurotensin receptor activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0001659 temperature homeostasis
GO:0003085 negative regulation of systemic arterial blood pressure
GO:0003254 regulation of membrane depolarization
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007268 chemical synaptic transmission
GO:0007612 learning
GO:0008344 adult locomotory behavior
GO:0010628 positive regulation of gene expression
GO:0014049 positive regulation of glutamate secretion
GO:0014054 positive regulation of gamma-aminobutyric acid secretion
GO:0033993 response to lipid
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043576 regulation of respiratory gaseous exchange
GO:0050965 detection of temperature stimulus involved in sensory perception of pain
GO:0051280 negative regulation of release of sequestered calcium ion into cytosol
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0060732 positive regulation of inositol phosphate biosynthetic process
GO:0070779 D-aspartate import across plasma membrane
GO:0071545 inositol phosphate catabolic process
GO:0090238 positive regulation of arachidonate secretion
GO:0097151 positive regulation of inhibitory postsynaptic potential
GO:0098712 L-glutamate import across plasma membrane
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0032280 symmetric synapse
GO:0043025 neuronal cell body
GO:0043195 terminal bouton
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0044309 neuron spine
GO:0045121 membrane raft

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osa, PDBe:6osa, PDBj:6osa
PDBsum6osa
PubMed31243364
UniProtP30989|NTR1_HUMAN Neurotensin receptor type 1 (Gene Name=NTSR1)

[Back to BioLiP]