Structure of PDB 6oig Chain R

Receptor sequence

>6oigR (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 6oig An open interface in the pre-80S ribosome coordinated by ribosome assembly factors Tsr1 and Dim1 enables temporal regulation of Fap7.
• Chain: R
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	A137 N138 L139 R140 R144 G153 K154 R155 K156 L159 P161 R173 K178 K181 T191 V192 H193 S194 K195 S196 R197 R199 R206 E207 R209 H210 Y213 G214 K215 R216 K217 G218 R220 A222 R223 Q227 W230 I231 R235 R238 R239 K249 K252 H253 Y255 H256 Y259 K260 K263 G264 H269 R271 K281	A1 N2 L3 R4 R8 G17 K18 R19 K20 L23 P25 R37 K42 K45 T55 V56 H57 S58 K59 S60 R61 R63 R70 E71 R73 H74 Y77 G78 K79 R80 K81 G82 R84 A86 R87 Q91 W94 I95 R99 R102 R103 K113 K116 H117 Y119 H120 Y123 K124 K127 G128 H133 R135 K145

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6oig, PDBe:6oig, PDBj:6oig
• PDBsum: 6oig
• PubMed: 33219089
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)