Structure of PDB 6o8z Chain R

Receptor sequence

>6o8zR (length=118) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

ARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRR
QKKRDFRKLWIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVN
DAAAFTALAEQAKDALSK

3D structure

PDB

6o8z Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.

Chain

Resolution

3.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	A2 R3 V4 G7 T8 T10 R11 R13 R14 K15 K16 K19 K22 G23 Y24 Y25 G26 K28 H29 T30 L31 F32 K33 E37 Q38 Y45 R48 D49 R50 R51 K53 K54 R55 F57 R58 N66 Y76 H81 K84 N91 R92 K93	A1 R2 V3 G6 T7 T9 R10 R12 R13 K14 K15 K18 K21 G22 Y23 Y24 G25 K27 H28 T29 L30 F31 K32 E36 Q37 Y44 R47 D48 R49 R50 K52 K53 R54 F56 R57 N65 Y75 H80 K83 N90 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links