Structure of PDB 6lss Chain R

Receptor sequence
>6lssR (length=150) Species: 9606 (Homo sapiens) [Search protein sequence]
IHPYSRKAAQITREAHKQEKKEKLKNEKALRLNLVGEKLQWFQNHLDPQK
KRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQT
MERERQQFEGYGLEIPDILNASNLKTFREWDFDLKKLPNIKMRKICANDA
3D structure
PDB6lss Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
ChainR
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R H18 S21 R22 R29 K33 K37 I98 R99 D100 Q102 H106 C107 L135 N136 H2 S5 R6 R13 K17 K21 I82 R83 D84 Q86 H90 C91 L119 N120
BS02 rna R H32 K36 K44 R47 K151 P154 N155 H16 K20 K28 R31 K135 P138 N139
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:1990275 preribosome binding
Biological Process
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lss, PDBe:6lss, PDBj:6lss
PDBsum6lss
PubMed32669547
UniProtQ96EY4|TMA16_HUMAN Translation machinery-associated protein 16 (Gene Name=TMA16)

[Back to BioLiP]