Structure of PDB 6kw5 Chain R

Receptor sequence
>6kw5R (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6kw5 Structure of the RSC complex bound to the nucleosome
ChainR
Resolution10.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna R R49 K56 R63 K64 L65 P66 R69 R11 K18 R25 K26 L27 P28 R31
BS02 dna R H39 R40 Y41 R42 T45 R83 F84 Q85 V117 T118 H1 R2 Y3 R4 T7 R45 F46 Q47 V79 T80
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6kw5, PDBe:6kw5, PDBj:6kw5
PDBsum6kw5
PubMed
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]