Structure of PDB 6kad Chain R

Receptor sequence

>6kadR (length=240) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

RSGGVGYRKYQGDALWLPNTTRPEWLDGSLPGDRGFDPLGLSKPSEFVVI
GVDENDQNAAKNNKGSVEAIVQATPDEVSSENRLAPYSEVFGLARFRECE
LIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQL
IWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTA
EIKHARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNG

3D structure

PDB

6kad Structural insight into light harvesting for photosystem II in green algae.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	R	L63 G69 D70 R71 F73 L78 F133 R134 C136 E137 R243 M246	L26 G32 D33 R34 F36 L41 F96 R97 C99 E100 R206 M209
BS02	CLA	R	R132 F133 H140	R95 F96 H103
BS03	CLA	R	G150 A154 E169 Y175 A176	G113 A117 E132 Y138 A139
BS04	CHL	R	L180 F182 L187 I190 E191	L143 F145 L150 I153 E154
BS05	CHL	R	G166 K167 E191 L257	G129 K130 E154 L220
BS06	CHL	R	I139 R142 W143 A198 Y201 R202 P214 F218	I102 R105 W106 A161 Y164 R165 P177 F181
BS07	CLA	R	C136 W143 G196 E199 R202	C99 W106 G159 E162 R165
BS08	CLA	R	R142 M145 Y213 P214 G215 L223 A224 L234 K235 A237 E238	R105 M108 Y176 P177 G178 L186 A187 L197 K198 A200 E201
BS09	CLA	R	A237 K240 H241	A200 K203 H204
BS10	CLA	R	G251 V254 Q255 F270	G214 V217 Q218 F233
BS11	CLA	R	L121 A122 P123 Y124 E126 V127 F200 N203	L84 A85 P86 Y87 E89 V90 F163 N166

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding
GO:0046872	metal ion binding

	Biological Process
GO:0009765	photosynthesis, light harvesting
GO:0015979	photosynthesis

	Cellular Component
GO:0009503	thylakoid light-harvesting complex
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6kad, PDBe:6kad, PDBj:6kad
PDBsum	6kad
PubMed	31768031
UniProt	Q93WD2\|CB29_CHLRE Chlorophyll a-b binding protein CP29 (Gene Name=Lhcb4)

[Back to BioLiP]