Structure of PDB 6kac Chain R

Receptor sequence

>6kacR (length=183) Species: 3055 (Chlamydomonas reinhardtii)

RPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIV
QAGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYA
GLSLPFSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASE
DEERAFRLKTAEIKHARLAMVSFFGYGVQALST

3D structure

• PDB: 6kac Structural insight into light harvesting for photosystem II in green algae.
• Chain: R
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	R	L63 L67 G69 R71 L78 S79 F133 R134 E137 R243 M246	L5 L9 G11 R13 L20 S21 F57 R58 E61 R167 M170
BS02	CLA	R	L146 G150 V153 A154 T158 A165 E169 S174 Y175 A176	L70 G74 V77 A78 T82 A89 E93 S98 Y99 A100
BS03	CHL	R	E169 L180 F182 L187 I190 E191 V195	E93 L104 F106 L111 I114 E115 V119
BS04	CHL	R	V163 E164 A165 G166 K167 E191	V87 E88 A89 G90 K91 E115
BS05	CHL	R	R142 W143 A198 Y201 R202 P214 F218	R66 W67 A122 Y125 R126 P138 F142
BS06	CLA	R	C136 I139 H140 W143 E199 F200 R202 N203	C60 I63 H64 W67 E123 F124 R126 N127
BS07	CLA	R	R142 M145 L146 Y213 P214 L223 A237 E238	R66 M69 L70 Y137 P138 L147 A161 E162
BS08	CHL	R	Y175 L178	Y99 L102

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009765 photosynthesis, light harvesting
• GO:0015979 photosynthesis

Cellular Component

• GO:0009503 thylakoid light-harvesting complex
• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009523 photosystem II
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:6kac, PDBe:6kac, PDBj:6kac
• PDBsum: 6kac
• PubMed: 31768031
• UniProt: Q93WD2|CB29_CHLRE Chlorophyll a-b binding protein CP29 (Gene Name=Lhcb4)