Structure of PDB 6i7o Chain R

Receptor sequence

>6i7oR (length=217) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNI
KPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAK
LSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPA
VKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQ
PLPVSPLDIYSDEASAQ

3D structure

PDB

6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.

Chain

Resolution

5.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	V86 Q87 K88 Q89 R91 A92 R95 K99 K119 T159 K161 G163 S164 R168 V179 A180 Y197 T198 Q199 S200 N201 K203 T204 R205 T206 N209 K212	V53 Q54 K55 Q56 R58 A59 R62 K66 K86 T126 K128 G130 S131 R135 V146 A147 Y164 T165 Q166 S167 N168 K170 T171 R172 T173 N176 K179
BS02	rna	R	I83 I125 R126	I50 I92 R93

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum	6i7o
PubMed	30609991
UniProt	P25443\|RS2_YEAST Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]