Structure of PDB 6gqb Chain R

Receptor sequence

>6gqbR (length=188) Species: 559292 (Saccharomyces cerevisiae S288C)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: R
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	N3 L4 R5 T6 K8 V17 G18 K19 R20 K21 L24 P26 S37 R38 N39 R42 K43 K46 T56 H58 S59 K60 S61 R62 R64 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 E86 A87 R88 L89 Q92 W95 I96 R100 R103 R104 R110 H118 Y120 H121 Y124 K125 K128 N130 H134 K135 I143	N2 L3 R4 T5 K7 V16 G17 K18 R19 K20 L23 P25 S36 R37 N38 R41 K42 K45 T55 H57 S58 K59 S60 R61 R63 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 E85 A86 R87 L88 Q91 W94 I95 R99 R102 R103 R109 H117 Y119 H120 Y123 K124 K127 N129 H133 K134 I142
BS02	rna	R	R162 R163 K165 N166 R176 V177	R161 R162 K164 N165 R175 V176

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
• PDBsum: 6gqb
• PubMed: 29886014
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)