Structure of PDB 6g4w Chain R

Receptor sequence
>6g4wR (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
GRVRTKTVKKAARVIIEKYYTRLNDFHTNKRVCEEIIIPSKKLRNKIAGY
VTHLMKRIQRGPVRGISIKLQEEERERRDNY
3D structure
PDB6g4w Visualizing late states of human 40S ribosomal subunit maturation.
ChainR
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K45 N48 K49 G52 T55 K42 N45 K46 G49 T52
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0006413 translational initiation
GO:0034101 erythrocyte homeostasis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6g4w, PDBe:6g4w, PDBj:6g4w
PDBsum6g4w
PubMed29875412
UniProtP08708|RS17_HUMAN Small ribosomal subunit protein eS17 (Gene Name=RPS17)

[Back to BioLiP]