Structure of PDB 6ff7 Chain R |
>6ff7R (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] |
KGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERE RAAAREKNRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKY IK |
|
PDB | 6ff7 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex. |
Chain | R |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
R |
P36 S37 H38 |
P19 S20 H21 |
|
|
|
|