Structure of PDB 6car Chain R

Receptor sequence
>6carR (length=70) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAK
TIKRARILGLLPFTEKLVRK
3D structure
PDB6car Aminoglycoside ribosome interactions reveal novel conformational states at ambient temperature.
ChainR
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K49 I50 R53 K61 R64 K68 K71 R72 R74 I75 F81 K31 I32 R35 K43 R46 K50 K53 R54 R56 I57 F63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6car, PDBe:6car, PDBj:6car
PDBsum6car
PubMed30113694
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]