Structure of PDB 5zwn Chain R

Receptor sequence

>5zwnR (length=184) Species: 559292 (Saccharomyces cerevisiae S288C)

TRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNH
KRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTS
IDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANSRSRDETCES
NPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSV

3D structure

• PDB: 5zwn Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
• Chain: R
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	H24 K28 R139 N141	H23 K27 R138 N140
BS02	rna	R	R3 H15 T17 V20 D36 Y37 R39 N40 R43 H49 R53 R54 H55 G57 K58 R59 G60 E63 K74 V75 C77 N80 K81 K83 M87	R2 H14 T16 V19 D35 Y36 R38 N39 R42 H48 R52 R53 H54 G56 K57 R58 G59 E62 K73 V74 C76 N79 K80 K82 M86
BS03	ZN	R	C6 C9 H24 H30	C5 C8 H23 H29

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0008270 zinc ion binding
• GO:0030619 U1 snRNA binding
• GO:0030627 pre-mRNA 5'-splice site binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5zwn, PDBe:5zwn, PDBj:5zwn
• PDBsum: 5zwn
• PubMed: 29794219
• UniProt: Q05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)