Structure of PDB 5v7q Chain R

Receptor sequence
>5v7qR (length=98) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
YAIVKTGGKQYKVAVGDVVKVEKLESEQGEKVSLPVALVVDGATVTTDAK
ALAKVAVTGEVLGHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTG
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
ChainR
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R G11 K13 K27 K70 K73 R75 K78 F79 K80 N81 K82 T83 Y85 K87 R88 Q89 G90 H91 R92 Q93 G7 K9 K23 K66 K69 R71 K74 F75 K76 N77 K78 T79 Y81 K83 R84 Q85 G86 H87 R88 Q89
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WHC3|RL21_MYCTU Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]