Structure of PDB 5no3 Chain R

Receptor sequence
>5no3R (length=55) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLP
YTDRH
3D structure
PDB5no3 RsgA couples the maturation state of the 30S ribosomal decoding center to activation of its GTPase pocket.
ChainR
Resolution5.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K38 I39 P41 R48 A49 K50 Q52 R53 K60 R63 Y64 Y70 K19 I20 P22 R29 A30 K31 Q33 R34 K41 R44 Y45 Y51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5no3, PDBe:5no3, PDBj:5no3
PDBsum5no3
PubMed28482099
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]