Structure of PDB 5njt Chain R

Receptor sequence
>5njtR (length=71) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
RAKRRKVCYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQR
KLTAAIKRARQMALLPYVSGE
3D structure
PDB5njt Structure of the Bacillus subtilis hibernating 100S ribosome reveals the basis for 70S dimerization.
ChainR
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K43 I44 K55 K35 I36 K47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5njt, PDBe:5njt, PDBj:5njt
PDBsum5njt
PubMed28468753
UniProtP21475|RS18_BACSU Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]