Structure of PDB 5ldw Chain R |
>5ldwR (length=89) Species: 9913 (Bos taurus) [Search protein sequence] |
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAACDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQ |
|
PDB | 5ldw Structure of mammalian respiratory complex I. |
Chain | R |
Resolution | 4.27 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
R |
C59 H68 C84 C87 |
C55 H64 C80 C83 |
|
|
|