Structure of PDB 5juu Chain R

Receptor sequence
>5juuR (length=136) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAG
VPRQAINLGQVVLTPLTFALPRGARTATVSKKWAAAAVCEKWAASSWAKK
IAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA
3D structure
PDB5juu Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
ChainR
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R I6 S10 W12 R13 P73 R74 G75 A76 R77 T80 W99 R106 R109 M121 V122 R124 K125 Y129 K132 K133 I4 S8 W10 R11 P71 R72 G73 A74 R75 T78 W97 R104 R107 M119 V120 R122 K123 Y127 K130 K131
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016236 macroautophagy
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5juu, PDBe:5juu, PDBj:5juu
PDBsum5juu
PubMed27159452
UniProtP36105|RL14A_YEAST Large ribosomal subunit protein eL14A (Gene Name=RPL14A)

[Back to BioLiP]