Structure of PDB 5gm6 Chain R

Receptor sequence

>5gm6R (length=261) Species: 559292 (Saccharomyces cerevisiae S288C)

MTSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSP
FALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIG
KLALRTEVLDCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKH
LKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMS
NQTLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQEELKLESLNMM
VHLINNNTNSA

3D structure

• PDB: 5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
• Chain: R
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	P19 Y34 S38 Q39 G40 F41 F47 S49 F72 F75 M80 C81 Y89 F112 F117 Y120 R121 G126 I127 K196 S200 N201 L222 V223	P19 Y34 S38 Q39 G40 F41 F47 S49 F72 F75 M80 C81 Y89 F112 F117 Y120 R121 G126 I127 K196 S200 N201 L222 V223
BS02	rna	R	F41 A42 G43 Y138 G141 R174 K179 F183 W225 A226 N227 D229 P230 D231	F41 A42 G43 Y138 G141 R174 K179 F183 W225 A226 N227 D229 P230 D231
BS03	ZN	R	C73 C81 C87 H91	C73 C81 C87 H91

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0017070 U6 snRNA binding
• GO:0036002 pre-mRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000387 spliceosomal snRNP assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0033120 positive regulation of RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome
• GO:0045787 positive regulation of cell cycle

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome

External links

• PDB: RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
• PDBsum: 5gm6
• PubMed: 27445306
• UniProt: Q12046|CWC2_YEAST Pre-mRNA-splicing factor CWC2 (Gene Name=CWC2)