Structure of PDB 4x23 Chain R

Receptor sequence
>4x23R (length=88) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
3D structure
PDB4x23 A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
ChainR
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna R E32 I36 Y37 E1 I5 Y6 PDBbind-CN: Kd=0.1uM
BS02 dna R Y39 I51 S53 R83 S84 T85 Y8 I20 S22 R52 S53 T54 PDBbind-CN: Kd=0.1uM
BS03 peptide R Q44 V45 E102 L103 H106 Q13 V14 E71 L72 H75
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4x23, PDBe:4x23, PDBj:4x23
PDBsum4x23
PubMed23723239
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]