Structure of PDB 4lf8 Chain R

Receptor sequence
>4lf8R (length=73) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRI
LAKTIKRARILGLLPFTEKLVRK
3D structure
PDB4lf8 Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
ChainR
Resolution3.1484 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K49 I50 A60 K61 Q63 R64 K68 K71 R72 R74 I75 F81 K34 I35 A45 K46 Q48 R49 K53 K56 R57 R59 I60 F66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lf8, PDBe:4lf8, PDBj:4lf8
PDBsum4lf8
PubMed
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]