Structure of PDB 4lf4 Chain R

Receptor sequence
>4lf4R (length=73) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRI
LAKTIKRARILGLLPFTEKLVRK
3D structure
PDB4lf4 Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
ChainR
Resolution3.3421 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K49 I50 R53 A60 K61 Q63 R64 K68 K71 R72 R74 I75 F81 K34 I35 R38 A45 K46 Q48 R49 K53 K56 R57 R59 I60 F66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lf4, PDBe:4lf4, PDBj:4lf4
PDBsum4lf4
PubMed
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]