Structure of PDB 4ji7 Chain R

Receptor sequence

>4ji7R (length=70) Species: 300852 (Thermus thermophilus HB8)

KAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAK
TIKRARILGLLPFTEKLVRK

3D structure

• PDB: 4ji7 The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
• Chain: R
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	K49 I50 R53 A60 K61 Q63 R64 K68 K71 R72 R74 I75 F81	K31 I32 R35 A42 K43 Q45 R46 K50 K53 R54 R56 I57 F63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4ji7, PDBe:4ji7, PDBj:4ji7
• PDBsum: 4ji7
• PubMed: 24152548
• UniProt: Q5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)