Structure of PDB 4gd3 Chain R

Receptor sequence

>4gd3R (length=300) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAG
TQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAA
AGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIP
DVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQ
SWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFCIQSGHGCLGCA
ENGFWDRGSFYSRVVDIPQMGTHSTADTVGLTALGVVAAAVGVHAVASAV

3D structure

PDB

4gd3 Crystal Structure of the O(2)-Tolerant Membrane-Bound Hydrogenase 1 from Escherichia coli in Complex with Its Cognate Cytochrome b.

Chain

Resolution

3.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	C149 C249 C252
Catalytic site (residue number reindexed from 1)	C146 C246 C249
Enzyme Commision number	1.12.99.6: hydrogenase (acceptor).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	R	H187 C190 R192 R193 F196 C215 L216 Y217 C221 P224 I243	H184 C187 R189 R190 F193 C212 L213 Y214 C218 P221 I240
BS02	SF4	R	N228 C230 W235 C242 C249 L250 G251 C252	N225 C227 W232 C239 C246 L247 G248 C249
BS03	F4S	R	C17 C19 C20 G113 C115 C120 C149	C14 C16 C17 G110 C112 C117 C146

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008901	ferredoxin hydrogenase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0033748	hydrogenase (acceptor) activity
GO:0046872	metal ion binding
GO:0051536	iron-sulfur cluster binding
GO:0051538	3 iron, 4 sulfur cluster binding
GO:0051539	4 iron, 4 sulfur cluster binding

	Biological Process
GO:0006113	fermentation
GO:0009061	anaerobic respiration
GO:0009267	cellular response to starvation
GO:0019645	anaerobic electron transport chain
GO:1902421	hydrogen metabolic process

	Cellular Component
GO:0005886	plasma membrane
GO:0009375	ferredoxin hydrogenase complex
GO:0016020	membrane
GO:0044569	[Ni-Fe] hydrogenase complex
GO:0098567	periplasmic side of plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4gd3, PDBe:4gd3, PDBj:4gd3
PDBsum	4gd3
PubMed	23260654
UniProt	P69739\|MBHS_ECOLI Hydrogenase-1 small chain (Gene Name=hyaA)

[Back to BioLiP]