Structure of PDB 3qpb Chain R

Receptor sequence
>3qpbR (length=246) Species: 301450 (Streptococcus pyogenes serotype M6) [Search protein sequence]
VGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAEHFDNAVLVADSREYVTYT
GTLNGEKVSVTSTGIGGPSASIAMEELKLCGADTFIRVGTCGGIELDVKG
GDIVIATGAIRMEGTSKEYAPIEFPAVADLEVTNALVNAAKKLGYTSHAG
VVQCKDAFYGQHEPERMPVSYELLNKWEAWKRLGTKASEMESAALFVAAS
HLGVRCGSDFLVVGNQERNALGMDNPMEAAIQVAVEALRTLIENDK
3D structure
PDB3qpb The Crystal Structure of Streptococcus pyogenes Uridine Phosphorylase Reveals a Distinct Subfamily of Nucleoside Phosphorylases.
ChainR
Resolution1.82 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 R1P R H13 R51 H6 R44
BS02 R1P R G29 R94 T97 F165 E196 M197 E198 G22 R87 T90 F158 E189 M190 E191
BS03 URA R T97 C98 G99 K162 Q168 T90 C91 G92 K155 Q161
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Nov 24 16:19:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3qpb', asym_id = 'R', title = 'The Crystal Structure of Streptococcus pyogenes ... Distinct Subfamily of Nucleoside Phosphorylases.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3qpb', asym_id='R', title='The Crystal Structure of Streptococcus pyogenes ... Distinct Subfamily of Nucleoside Phosphorylases.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003824,0004850,0005737,0009116,0009166,0016763', uniprot = '', pdbid = '3qpb', asym_id = 'R'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0004850,0005737,0009116,0009166,0016763', uniprot='', pdbid='3qpb', asym_id='R')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>