Structure of PDB 3pio Chain R

Receptor sequence
>3pioR (length=110) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]
PSAGSHHNDKLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNV
ITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATRVRKQIVDGKK
VRVAVASGKT
3D structure
PDB3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
ChainR
Resolution3.2473 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R P4 S5 H9 H10 N11 K13 H15 K17 K18 S26 G27 K28 K30 A39 P41 K45 V53 T55 K56 V58 G67 G68 L74 H77 R93 R95 K102 P1 S2 H6 H7 N8 K10 H12 K14 K15 S23 G24 K25 K27 A36 P38 K42 V50 T52 K53 V55 G64 G65 L71 H74 R90 R92 K99
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum3pio
PubMed21282615
UniProtQ9RXJ1|RL24_DEIRA Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]