Structure of PDB 3i56 Chain R

Receptor sequence

>3i56R (length=150) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAV
IEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNAD
HQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP

3D structure

PDB

3i56 Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	G1 I2 S3 Y4 S5 K15 M17 R19 S24 F25 K26 K29 K60 Q61 H62 S64 G65 G67 H68 K69 S70 K71 G74 W75 D76 R79 Y80 E82 K83 N94 N98 H101 H113 A115 A116 H117 V119 Q122 K126 P127 R128 A129 M130 G131 R132 A133 S134 A135 W136 N137 S138	G1 I2 S3 Y4 S5 K15 M17 R19 S24 F25 K26 K29 K60 Q61 H62 S64 G65 G67 H68 K69 S70 K71 G74 W75 D76 R79 Y80 E82 K83 N94 N98 H101 H113 A115 A116 H117 V119 Q122 K126 P127 R128 A129 M130 G131 R132 A133 S134 A135 W136 N137 S138

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3i56, PDBe:3i56, PDBj:3i56
PDBsum	3i56
PubMed	19738021
UniProt	P10970\|RL22_HALMA Large ribosomal subunit protein uL22 (Gene Name=rpl22)

[Back to BioLiP]