Structure of PDB 3cxc Chain R

Receptor sequence
>3cxcR (length=81) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVE
QVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
3D structure
PDB3cxc Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R S1 H9 T11 E12 K13 Q21 K23 R31 S33 K34 N53 Q55 N56 M58 K62 K63 S1 H9 T11 E12 K13 Q21 K23 R31 S33 K34 N53 Q55 N56 M58 K62 K63 PDBbind-CN: IC50=4.6uM
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3cxc, PDBe:3cxc, PDBj:3cxc
PDBsum3cxc
PubMed18947996
UniProtP12732|RL23_HALMA Large ribosomal subunit protein uL23 (Gene Name=rpl23)

[Back to BioLiP]