Structure of PDB 2ykr Chain R

Receptor sequence
>2ykrR (length=55) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLP
YTDRH
3D structure
PDB2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
ChainR
Resolution9.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R S35 G36 K37 I38 V39 P40 S41 R47 A48 K49 Q51 R52 Q53 R56 K59 R60 Y63 Y69 T70 D71 R72 H73 S17 G18 K19 I20 V21 P22 S23 R29 A30 K31 Q33 R34 Q35 R38 K41 R42 Y45 Y51 T52 D53 R54 H55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum2ykr
PubMed21788480
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]