Structure of PDB 2uu9 Chain R

Receptor sequence

>2uu9R (length=73) Species: 300852 (Thermus thermophilus HB8)

PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRI
LAKTIKRARILGLLPFTEKLVRK

3D structure

• PDB: 2uu9 Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
• Chain: R
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	K49 I50 K61 Q63 R64 K68 K71 R72 R74 I75 F81	K34 I35 K46 Q48 R49 K53 K56 R57 R59 I60 F66

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2uu9, PDBe:2uu9, PDBj:2uu9
• PDBsum: 2uu9
• PubMed: 17496902
• UniProt: Q5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)