Structure of PDB 2qkk Chain R

Receptor sequence
>2qkkR (length=148) Species: 9606 (Homo sapiens) [Search protein sequence]
HMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQR
AEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSA
GKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAK
3D structure
PDB2qkk Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
ChainR
Resolution3.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D145 G146 E186 N210 H264 D274
Catalytic site (residue number reindexed from 1) D11 G12 E52 N76 H130 D140
Enzyme Commision number 3.1.26.4: ribonuclease H.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R C148 S149 S150 N151 R153 N182 E186 N210 M212 C14 S15 S16 N17 R19 N48 E52 N76 M78
BS02 dna R N151 R179 T181 N182 Q183 F213 W225 T232 S233 V238 I239 N240 N17 R45 T47 N48 Q49 F79 W91 T98 S99 V104 I105 N106
BS03 CA R D145 D274 D11 D140
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkk, PDBe:2qkk, PDBj:2qkk
PDBsum2qkk
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]