Structure of PDB 2om1 Chain R

Receptor sequence
>2om1R (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB2om1 Crystallographic characterization of two novel crystal forms of human insulin induced by chaotropic agents and a shift in pH.
ChainR
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R Q4 C7 L11 L15 V18 C19 R22 G23 F24 Y26 T30 Q4 C7 L11 L15 V18 C19 R22 G23 F24 Y26 T30
BS02 peptide R F1 V2 F1 V2
BS03 peptide R N3 L6 H10 N3 L6 H10
BS04 peptide R H5 G8 S9 V12 Y16 E21 G23 F24 F25 Y26 H5 G8 S9 V12 Y16 E21 G23 F24 F25 Y26
BS05 peptide R E13 L17 E13 L17
BS06 RCO R H10 L11 H10 L11
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2om1, PDBe:2om1, PDBj:2om1
PDBsum2om1
PubMed18093308
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]