Structure of PDB 1rzz Chain R

Receptor sequence

>1rzzR (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHENTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 1rzz X-Ray Structure Determination of Three Mutants of the Bacterial Photosynthetic Reaction Centers from Rb. sphaeroides; Altered Proton Transfer Pathways.
• Chain: R
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	R	F97 V157 Y162 F167 H168 H173 I177 F180 S244 A245 M248	F97 V157 Y162 F167 H168 H173 I177 F180 S244 A245 M248
BS02	BPH	R	A93 W100 E104 I117 A120 F121 A124 Y148 H153 V241	A93 W100 E104 I117 A120 F121 A124 Y148 H153 V241
BS03	U10	R	L189 F216 Y222 S223 I224 I229	L189 F216 Y222 S223 I224 I229
BS04	FE2	R	H190 H230	H190 H230
BS05	BCL	R	M174 I177 S178 T182 L185	M174 I177 S178 T182 L185
BS06	BCL	R	L131 F146 I150 H153 L154	L131 F146 I150 H153 L154
BS07	BPH	R	F181 L185 L189	F181 L185 L189

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1rzz, PDBe:1rzz, PDBj:1rzz
• PDBsum: 1rzz
• PubMed: 15062092
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)