Structure of PDB 1q7y Chain R

Receptor sequence

>1q7yR (length=95) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNG
RFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE

3D structure

PDB

1q7y Structural Insights Into Peptide Bond Formation

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	P1 S2 S3 N4 G5 P6 L7 E8 G9 R11 K13 L14 K15 R21 G22 T23 K38 H40 K42 P45 S46 P48 R55 D57 G58 Q59 T60 Q67 G68 A70 D77 G79 K80 K82 T83 I85 Q94 E95	P1 S2 S3 N4 G5 P6 L7 E8 G9 R11 K13 L14 K15 R21 G22 T23 K38 H40 K42 P45 S46 P48 R55 D57 G58 Q59 T60 Q67 G68 A70 D77 G79 K80 K82 T83 I85 Q94 E95
BS02	rna	R	R19 P25 Q27	R19 P25 Q27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:1q7y, PDBe:1q7y, PDBj:1q7y
PDBsum	1q7y
PubMed	12185246
UniProt	P12734\|RL21_HALMA Large ribosomal subunit protein eL21 (Gene Name=rpl21e)