Structure of PDB 1l9j Chain R

Receptor sequence

>1l9jR (length=281) Species: 1063 (Cereibacter sphaeroides)

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

• PDB: 1l9j X-ray structure determination of the cytochrome c2: reaction center electron transfer complex from Rhodobacter sphaeroides.
• Chain: R
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	R	F97 A124 I125 Y128 V157 Y162 F167 H168 H173 I177 F180 F181 S244 A245 M248	F97 A124 I125 Y128 V157 Y162 F167 H168 H173 I177 F180 F181 S244 A245 M248
BS02	BCL	R	I46 Y128 L131 F146 I150 W151 H153 L154	I46 Y128 L131 F146 I150 W151 H153 L154
BS03	BPH	R	F181 L185 L189	F181 L185 L189
BS04	FE2	R	H190 H230	H190 H230
BS05	BCL	R	H168 M174 I177 S178 T182	H168 M174 I177 S178 T182
BS06	BPH	R	A93 A96 W100 E104 F121 Y148 V241	A93 A96 W100 E104 F121 Y148 V241

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009772 photosynthetic electron transport in photosystem II
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1l9j, PDBe:1l9j, PDBj:1l9j
• PDBsum: 1l9j
• PubMed: 12051924
• UniProt: P0C0Y8|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)