Structure of PDB 8gym Chain Qh |
>8gymQh (length=129) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] |
MNVTGAGLTHVKDFHSDEMRVFRGGLRHIADKQGNLIYGSVNSSVRYYHD KMSYERGFIQHSRSPSNQFINFHFMLGGFRTYVLERFFKQVWYRRNIRTF WFPVLISYTSGCITMRMYDNNCYDYFYFS |
|
PDB | 8gym Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae. |
Chain | Qh |
Resolution | 2.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U10 |
Qh |
S110 G111 |
S110 G111 |
|
|
|