Structure of PDB 8iuf Chain Qe

Receptor sequence
>8iufQe (length=231) Species: 3039 (Euglena gracilis) [Search protein sequence]
NAVGGLATSQIRDLVGNPAKSGKPVVKMPPYLKPSQLRPSRGAYSDEFVR
ENYIKAADPEDPYNYRSRAFTYAAKIPMWAGLLAGTRVTVVYLMSQFMPS
KSSLALANIEVDIGDIPEGKTVTIMWQGKPVFLRKRTDAEIEDMRAVPMD
ALKDPQTDEERLGEGRWAVFMAVCTHLGCVPVIDQGSYNAYFCPCHGSHY
DHSGRIRKGPAPLNLEVPPFKLLDDSTLFIG
3D structure
PDB8iuf Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism.
ChainQe
Resolution2.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES Qe C190 H192 C195 C209 C211 H212 S214 C174 H176 C179 C193 C195 H196 S198
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 04:56:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8iuf', asym_id = 'Qe', title = "Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. "
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8iuf', asym_id='Qe', title="Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. ")
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008121,0016020,0051537', uniprot = '', pdbid = '8iuf', asym_id = 'Qe'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008121,0016020,0051537', uniprot='', pdbid='8iuf', asym_id='Qe')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>