Structure of PDB 8rdw Chain QZ

Receptor sequence
>8rdwQZ (length=79) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
ASVLTGRVVSDKMDKSITVLIERLVRHPLYGKQLRRSTKIKAHDENNVCQ
QGDLVRIKETRPISKTKAWTLVDVVEKVE
3D structure
PDB8rdw A new family of bacterial ribosome hibernation factors
ChainQZ
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna QZ S20 K22 M23 D24 K25 S26 R33 L39 Y40 K42 Q43 R45 R46 S47 T48 K49 K51 E69 R71 P72 I73 S74 K75 T76 K77 W79 S10 K12 M13 D14 K15 S16 R23 L29 Y30 K32 Q33 R35 R36 S37 T38 K39 K41 E59 R61 P62 I63 S64 K65 T66 K67 W69
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
PDBsum8rdw
PubMed38355796
UniProtA0A0M4U401

[Back to BioLiP]