Structure of PDB 4ypb Chain QY

Receptor sequence
>4ypbQY (length=91) Species: 585 (Proteus vulgaris) [Search protein sequence]
GIKSFKHKGLKLLFEKGVTSGVPAQDVDRINDRLQAIDTATEIGELNRQI
YKLHPLKGDREGYWSITVRANWRITFQFINGDAYILNYEDY
3D structure
PDB4ypb Defining the mRNA recognition signature of a bacterial toxin protein.
ChainQY
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna QY K6 K8 S20 A24 Q25 R29 I50 K52 H54 P55 R69 A70 N71 W72 K6 K8 S20 A24 Q25 R29 I50 K52 H54 P55 R69 A70 N71 W72
BS02 rna QY H54 L56 K57 G58 R73 Y91 H54 L56 K57 G58 R73 Y91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0030371 translation repressor activity
GO:0043022 ribosome binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006401 RNA catabolic process
GO:0008285 negative regulation of cell population proliferation
GO:0017148 negative regulation of translation
GO:0030308 negative regulation of cell growth

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:4ypb, PDBe:4ypb, PDBj:4ypb
PDBsum4ypb
PubMed26508639
UniProtQ7A225|HIGB_PROVU Endoribonuclease HigB (Gene Name=higB)

[Back to BioLiP]