Structure of PDB 8pfr Chain QX

Receptor sequence

>8pfrQX (length=120) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETA
MKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKA
YVRLTADYDALDIANRIGYI

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QX	L24 T31 R33 L34 P35 K36 K39 L40 R42 A43 K45 K75 N91 K92 Y93 K109 N111 T112 L113 V114 P116 K120 K121 Y123 R125	L2 T9 R11 L12 P13 K14 K17 L18 R20 A21 K23 K53 N69 K70 Y71 K87 N89 T90 L91 V92 P94 K98 K99 Y101 R103
BS02	rna	QX	T37 L38 R42 S48 K49 H53 Y54 N55 R56 K61 K89 Y93 Q94	T15 L16 R20 S26 K27 H31 Y32 N33 R34 K39 K67 Y71 Q72

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)