Structure of PDB 8p8n Chain QX

Receptor sequence

>8p8nQX (length=118) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

LKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAM
KKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAY
VRLTADYDALDIANRIGY

3D structure

PDB

8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QX	L24 T31 R33 L34 P35 K36 K39 L40 R42 A43 K45 Y46 S69 N91 K92 Y93 K109 N111 T112 L113 V114 P116 K120 Y123 R125	L1 T8 R10 L11 P12 K13 K16 L17 R19 A20 K22 Y23 S46 N68 K69 Y70 K86 N88 T89 L90 V91 P93 K97 Y100 R102
BS02	rna	QX	L24 T37 L38 R42 K49 H53 Y54 N55 R56 K61 K89 Y93 Q94	L1 T14 L15 R19 K26 H30 Y31 N32 R33 K38 K66 Y70 Q71

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum	8p8n
PubMed
UniProt	P04456\|RL25_YEAST Large ribosomal subunit protein uL23 (Gene Name=RPL25)