Structure of PDB 4l47 Chain QT

Receptor sequence

>4l47QT (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 4l47 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
• Chain: QT
• Resolution: 3.22 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QT	L10 K14 R15 H16 R17 S19 R22 R23 N26 K27 A28 S31 T35 K39 R57 E60 S61 D64 K65 K68 S70 K74 A78 R79 S82 R83 M85 R89 G101 G102 G103 L104 S105	L3 K7 R8 H9 R10 S12 R15 R16 N19 K20 A21 S24 T28 K32 R50 E53 S54 D57 K58 K61 S63 K67 A71 R72 S75 R76 M78 R82 G94 G95 G96 L97 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4l47, PDBe:4l47, PDBj:4l47
• PDBsum: 4l47
• PubMed: 25128388
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)