Structure of PDB 8pfr Chain QS

Receptor sequence

>8pfrQS (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QS	A2 N62 N65 H68 P69 K71 R84 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 L144 K146 H154 R155 Q157 K158 K161 Y165 S169 T170 F171	A1 N61 N64 H67 P68 K70 R83 H87 M89 Y90 K91 Q107 A110 A111 R112 H113 R114 R116 T131 R136 L143 K145 H153 R154 Q156 K157 K160 Y164 S168 T169 F170
BS02	rna	QS	R13 S39 R40 Y43 Q46 H49 K50 K52 R119	R12 S38 R39 Y42 Q45 H48 K49 K51 R118

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]