Structure of PDB 4w4g Chain QR

Receptor sequence
>4w4gQR (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILA
KTIKRARILGLLPFTEKLVRK
3D structure
PDB4w4g Defining the mRNA recognition signature of a bacterial toxin protein.
ChainQR
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna QR R18 K49 I50 R53 K61 Q63 R64 K71 R72 R74 I75 F81 R1 K32 I33 R36 K44 Q46 R47 K54 R55 R57 I58 F64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w4g, PDBe:4w4g, PDBj:4w4g
PDBsum4w4g
PubMed26508639
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]