Structure of PDB 8p8n Chain QQ

Receptor sequence

>8p8nQQ (length=147) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKAD

3D structure

PDB

8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QQ	A2 N3 L4 R5 T6 K8 R9 G18 K19 R20 K21 W23 L24 S37 R38 R42 K43 K46 T56 H58 S59 K60 S61 R62 T63 R64 R74 H75 G77 Y78 G79 R81 K82 G83 T84 R85 E86 A87 R88 L89 P90 Q92 W95 I96 R97 R100 V101 R103 R104 R110 H118 Y120 H121 Y124 K125 K128 G129 N130 H134 K135 R136	A1 N2 L3 R4 T5 K7 R8 G17 K18 R19 K20 W22 L23 S36 R37 R41 K42 K45 T55 H57 S58 K59 S60 R61 T62 R63 R73 H74 G76 Y77 G78 R80 K81 G82 T83 R84 E85 A86 R87 L88 P89 Q91 W94 I95 R96 R99 V100 R102 R103 R109 H117 Y119 H120 Y123 K124 K127 G128 N129 H133 K134 R135
BS02	MG	QQ	S91 Q92	S90 Q91

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
PDBsum	8p8n
PubMed
UniProt	P0CX82\|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)

[Back to BioLiP]