Structure of PDB 1vvj Chain QQ

Receptor sequence

>1vvjQQ (length=100) Species: 300852 (Thermus thermophilus HB8)

PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR

3D structure

• PDB: 1vvj Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
• Chain: QQ
• Resolution: 3.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QQ	P2 K3 S12 K14 M15 Q16 K17 R25 L31 Y32 K34 K37 R38 S39 K40 K41 Y42 E61 R63 P64 S66 K67 R68 K69 R70 R72 K87 R91 N94 Y95 K100	P1 K2 S11 K13 M14 Q15 K16 R24 L30 Y31 K33 K36 R37 S38 K39 K40 Y41 E60 R62 P63 S65 K66 R67 K68 R69 R71 K86 R90 N93 Y94 K99

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 06:40:55 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '1vvj', asym_id = 'QQ', title = 'Structural insights into +1 frameshifting promot...d or modification-deficient anticodon stem loops.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='1vvj', asym_id='QQ', title='Structural insights into +1 frameshifting promot...d or modification-deficient anticodon stem loops.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '1vvj', asym_id = 'QQ'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='1vvj', asym_id='QQ')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>