Structure of PDB 8pfr Chain QP

Receptor sequence

>8pfrQP (length=185) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

GIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKA
LFLSKINRPPVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTV
AALRFTAGARAKIVKAGGECITLDQLAVRAPKGQNTLILRGPRNSREAVR
HFGMGPHKGKAPRILSTGRKFERARGRRRSKGFKV

3D structure

PDB

8pfr Real-space refinement in PHENIX for cryo-EM and crystallography.

Chain

Resolution

2.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QP	G2 I3 H5 S7 K8 Q9 H10 K11 R12 S13 H15 R16 K20 S21 F35 R38 P43 F44 S55 K56 I57 S63 S65 R66 R69 Q73 K79 T86 T88 D89 D90 R92 T107 A108 N136 T137 I139 R141 P143 R144 N145 R147 E148 R151 F153 H158 A162 R164 S167 R170 K171 F172 R176 R179 S181 K182 G183 F184 K185	G1 I2 H4 S6 K7 Q8 H9 K10 R11 S12 H14 R15 K19 S20 F34 R37 P42 F43 S54 K55 I56 S62 S64 R65 R68 Q72 K78 T85 T87 D88 D89 R91 T106 A107 N135 T136 I138 R140 P142 R143 N144 R146 E147 R150 F152 H157 A161 R163 S166 R169 K170 F171 R175 R178 S180 K181 G182 F183 K184

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pfr, PDBe:8pfr, PDBj:8pfr
PDBsum	8pfr
PubMed
UniProt	P0CX49\|RL18A_YEAST Large ribosomal subunit protein eL18A (Gene Name=RPL18A)

[Back to BioLiP]