Structure of PDB 4zsn Chain QP

Receptor sequence

>4zsnQP (length=84) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQEA

3D structure

• PDB: 4zsn Mechanism of endonuclease cleavage by the HigB toxin.
• Chain: QP
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QP	M1 K3 R5 L6 R8 G10 S11 K12 H13 H16 Y17 R18 D23 R25 K27 R28 K31 Y32 I33 P41 R42 K43 T44 W59 G63 Q65 T67 T69 R72 R75 F80 R81 Q82	M1 K3 R5 L6 R8 G10 S11 K12 H13 H16 Y17 R18 D23 R25 K27 R28 K31 Y32 I33 P41 R42 K43 T44 W59 G63 Q65 T67 T69 R72 R75 F80 R81 Q82

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4zsn, PDBe:4zsn, PDBj:4zsn
• PDBsum: 4zsn
• PubMed: 27378776
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)