Structure of PDB 8p8n Chain QO

Receptor sequence

>8p8nQO (length=168) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKLTSRQRGRIAAQKRIA

3D structure

• PDB: 8p8n Real-space refinement in PHENIX for cryo-EM and crystallography.
• Chain: QO
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QO	R3 Y4 S16 R18 Y21 R23 S25 F26 K27 R30 Q34 Q55 R56 R62 F63 S65 S66 I67 G68 R69 A71 Q72 K74 E75 R82 W83 P84 K86 N97 N101 Q118 V119 Q121 Q125 R127 Y130 R131 A132 H133 G134 R135 I136 N137 K138 Y139 E140 S141 T169 S170 R171 Q172 R173 G174 R175 A178 I182	R2 Y3 S15 R17 Y20 R22 S24 F25 K26 R29 Q33 Q54 R55 R61 F62 S64 S65 I66 G67 R68 A70 Q71 K73 E74 R81 W82 P83 K85 N96 N100 Q117 V118 Q120 Q124 R126 Y129 R130 A131 H132 G133 R134 I135 N136 K137 Y138 E139 S140 T154 S155 R156 Q157 R158 G159 R160 A163 I167
BS02	rna	QO	R3 Y4 G5 A6 R61 R62 N120 Q121	R2 Y3 G4 A5 R60 R61 N119 Q120

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p8n, PDBe:8p8n, PDBj:8p8n
• PDBsum: 8p8n
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)