Structure of PDB 8p8m Chain QO

Receptor sequence

>8p8mQO (length=183) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 8p8m Yeast 60S ribosomal subunit, RPL39 deletion
• Chain: QO
• Resolution: 2.66 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	QO	R3 Y4 S16 A17 R18 Y21 R23 S25 K27 R30 Q34 Q55 R56 R62 F63 S65 S66 G68 R69 A71 Q72 K74 E75 R82 W83 K86 N97 N101 Q118 V119 Q121 R127 Y130 R131 A132 H133 G134 I136 N137 K138 Y139 E140 S141 T169 S170 R171 Q172 G174 R175 I182	R2 Y3 S15 A16 R17 Y20 R22 S24 K26 R29 Q33 Q54 R55 R61 F62 S64 S65 G67 R68 A70 Q71 K73 E74 R81 W82 K85 N96 N100 Q117 V118 Q120 R126 Y129 R130 A131 H132 G133 I135 N136 K137 Y138 E139 S140 T168 S169 R170 Q171 G173 R174 I181
BS02	rna	QO	R3 Y4 G5 R61 R62 N120 Q121 P123	R2 Y3 G4 R60 R61 N119 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p8m, PDBe:8p8m, PDBj:8p8m
• PDBsum: 8p8m
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)